PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08744-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 329aa    MW: 35786.9 Da    PI: 8.1513
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08744-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58.2e-40103162261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k+ 
  TRIUR3_08744-P1 103 PDKILPCPRCSSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSL 162
                      7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3299160IPR003851Zinc finger, Dof-type
PfamPF027011.7E-32105161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761107161IPR003851Zinc finger, Dof-type
PROSITE patternPS013610109145IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGQLRAAPGG GGDCLIKLFG KTIPVPDAGA GDVVDKDLQH RGSSATAEPK VQEIAPQDST  60
GSPPQQPEVV DVEDPSAAKN SAADQQDEEQ GDTANQKEKL KKPDKILPCP RCSSMDTKFC  120
YYNNYNINQP RHFCKNCQRY WTAGGAMRNV PVGAGRRKSK SLSAASHFLQ RIRAALPGDP  180
LCTPVNTNGT VLSFGSDAST LDVSEQMKHI KDLSSVTRTE NTDAPCFQSR KHPRDGDEER  240
DTKGNGKVWV PKTIRIDDVD EVARSSIWSL IGIKGDKEEK DDGKGCKLAR VFDPKDEAKT  300
SSHRGNNSLP FLKGNPAALS RSVNFHERS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2529240.0AK252924.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf174o03, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558722.11e-119PREDICTED: cyclic dof factor 1-like
TrEMBLM8B0K60.0M8B0K6_TRIUA; Dof zinc finger protein DOF5.5
STRINGBGIOSGA011947-PA1e-173(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-56cycling DOF factor 1